Recombinant Human IL24 Protein

Cat.No. : IL24-510H
Product Overview : Recombinant human IL24 protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Protein Length : 163
Description : This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Form : Lyophilized
AA Sequence : MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name IL24 interleukin 24 [ Homo sapiens (human) ]
Official Symbol IL24
Synonyms IL24; interleukin 24; ST16; interleukin-24; C49A; FISP; IL 4 induced secreted protein; IL 24; IL10B; mda 7; melanoma differentiation association protein 7; Mob 5; suppression of tumorigenicity 16 (melanoma differentiation); melanocyte-associated Mda-7; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; MDA7; MOB5;
Gene ID 11009
mRNA Refseq NM_001185156
Protein Refseq NP_001172085
MIM 604136
UniProt ID Q13007

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL24 Products

Required fields are marked with *

My Review for All IL24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon