Recombinant Active Mouse IL24 Protein, His-tagged(C-ter)
Cat.No. : | Il24-181M |
Product Overview : | Recombinant Active Mouse IL24 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Source : | E. coli |
Species : | Mouse |
Tag : | His |
Form : | Powder |
Bio-activity : | Determined by its ability to induce proliferation in BaF3 mouse pro-B cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is < 0.3 ng/mL. |
AA Sequence : | MQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il24 interleukin 24 [ Mus musculus ] |
Official Symbol | Il24 |
Synonyms | IL24; interleukin 24; interleukin-24; IL-24; th2-specific cytokine FISP; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; FISP; Mda7; St16; Mda-7; |
Gene ID | 93672 |
mRNA Refseq | NM_053095 |
Protein Refseq | NP_444325 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All IL24 Products
Required fields are marked with *
My Review for All IL24 Products
Required fields are marked with *
0
Inquiry Basket