Recombinant Human IGF2, StrepII-tagged
Cat.No. : | IGF2-212H |
Product Overview : | Purified, full-length human recombinant IGF2 protein (amino acids 93-126, 34 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 4 kDa. (Accession NP_000603.1; UniProt P01344) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 93-126, 34 a.a. |
Description : | IGF2 is a member of the insulin family of polypeptide growth factors, which are involved in development and growth. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ] |
Official Symbol | IGF2 |
Synonyms | IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066; |
Gene ID | 3481 |
mRNA Refseq | NM_000612 |
Protein Refseq | NP_000603 |
UniProt ID | P01344 |
Chromosome Location | 11p15.5 |
Pathway | Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; |
Function | growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; protein serine/threonine kinase activator activity; receptor activator activity; |
◆ Recombinant Proteins | ||
IGF2-5430H | Recombinant Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
IGF2-99R | Recombinant Rabbit IGF2 Protein | +Inquiry |
IGF2-2H | Active Recombinant Human IGF2 | +Inquiry |
IGF2-653B | Recombinant Bovine IGF2 protein(25-91aa), His&Myc-tagged | +Inquiry |
IGF2-816H | Recombinant Human IGF2 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
IGF2-29116TH | Native Human IGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
IGF2-5267HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF2 Products
Required fields are marked with *
My Review for All IGF2 Products
Required fields are marked with *
0
Inquiry Basket