Recombinant Rabbit IGF2 Protein

• Cat.No.: IGF2-99R
• Product Overview: Recombinant rabbit IGF-2 protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Species: Rabbit
• Source: Yeast
• Description: Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. The major role of IGF-2 is as a growth promoting hormone during gestation. IGF-2 is preferentially expressed in early embryonic and fetal development and in a wide variety of somatic tissues. IGF-2 expression in adults occurs in liver and in epithelial cells lining the surface of the brain. IGF-2 is present in circulation and can be detected in plasma, with circulating IGF-2 levels highest in fetal circulation.
• Molecular Mass: 7.5 kDa
• AA Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVNRRSRGIVEECCFRSCDLALLETYCATPAKSE(67)
• Applications: The swine/rabbit/dolphin IGF-2 endotoxin-free recombinant protein can be used in cell culture, as an ELISA Standard, and as a Western Blot Control.

Gene Information

• Gene Name: IGF2 insulin-like growth factor 2 (somatomedin A) [ Oryctolagus cuniculus (rabbit) ]
• Official Symbol: IGF2
• Synonyms: IGF2; insulin-like growth factor 2 (somatomedin A); insulin-like growth factor II
• Gene ID: 100328792
• mRNA Refseq: NM_001171406
• Protein Refseq: NP_001164877
• UniProt ID: B7NZU3