Native Human IGF2

• Cat.No.: IGF2-29116TH
• Product Overview: Human IGF-2.

Specification

• Species: Human
• Tag: Non
• Description: This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5 region overlaps the INS gene and the 3 region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: Human IGF-2 is a 7.5 kDa protein containing 67 amino acid residues:AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC CFRSCDLALLETYCATPAKSE
• Sequence Similarities: Belongs to the insulin family.

Gene Information

• Gene Name: IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ]
• Official Symbol: IGF2
• Synonyms: IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734
• Gene ID: 3481
• mRNA Refseq: NM_000612
• Protein Refseq: NP_000603
• Uniprot ID: P01344
• Chromosome Location: 11p15.5
• Pathway: Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem
• Function: growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding