Recombinant Human IGF1 protein

• Cat.No.: IGF1-524H
• Product Overview: Recombinant Human IGF1 protein (67 a.a.) was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 67
• Description: IGF-1 belonged to the insulin gene family, is a mitogenic polypeptide growth factor that stimulates the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. DES(1-3)IGF-1, is a truncated variant of human IGF-1 with the tripeptide Gly-Pro-Glu absent from the N-terminus. It has been isolated from bovine colostrum, human brain and porcine uterus. The DES(1-3)IGF-1 probably results from post-translational cleavage of IGF-1. It has about 10-fold more potent than IGF-1 at stimulating hypertrophy and proliferation of cultured cells, a consequence of much reduced binding to IGF-binding proteins, in turn caused by the absence of the glutamate at position 3. Clinical opportunities for DES(1-3)IGF-1 have not yet been evaluated, but could apply in catabolic states as well as for the treatment of inflammatory bowel diseases.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 7.4 kDa, a single non-glycosylated polypeptide chain containing 67 amino acids.
• AA Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Endotoxin: Less than 50 EU/mg of rHuDES1-3 IGF-1 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IGF1
• Official Symbol: IGF1
• Synonyms: IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I
• Gene ID: 3479
• mRNA Refseq: NM_000618
• Protein Refseq: NP_000609
• MIM: 147440
• UniProt ID: P05019