Recombinant Mouse Igf1 protein
Cat.No. : | Igf1-570M |
Product Overview : | Recombinant Mouse Igf1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 70 |
Description : | The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 7.7 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
AA Sequence : | GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA |
Endotoxin : | Less than 0.1 EU/μg of rMuIGF-1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 100mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Igf1 |
Official Symbol | Igf1 |
Synonyms | IGF1; insulin-like growth factor 1; insulin-like growth factor I; somatomedin; Igf-1; Igf-I; C730016P09Rik; |
Gene ID | 16000 |
mRNA Refseq | NM_001111274 |
Protein Refseq | NP_001104744 |
UniProt ID | P05017 |
◆ Recombinant Proteins | ||
IGF1-0242H | Active Recombinant Human IGF1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IGF1-140H | Recombinant Human IGF1 Protein | +Inquiry |
IGF1-986D | Recombinant Dog IGF1 Protein, His&GST-tagged | +Inquiry |
IGF1-4120H | Recombinant Human IGF1 protein, His-tagged | +Inquiry |
IGF1-3928H | Recombinant Human IGF1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Igf1 Products
Required fields are marked with *
My Review for All Igf1 Products
Required fields are marked with *
0
Inquiry Basket