Recombinant Human IFNE protein, GST-tagged

• Cat.No.: IFNE-54H
• Product Overview: Recombinant Human IFNE(109 a.a. - 208 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 Kda
• Protein length: 109 a.a. - 208 a.a.
• AA Sequence: FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLT EKLSKQGRPLNDMKQELTTEFRSPR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: IFNE interferon, epsilon [ Homo sapiens ]
• Official Symbol: IFNE
• Synonyms: IFNE; interferon, epsilon; interferon epsilon; IFNE1; IFN-epsilon; interferon tau-1; interferon-epsilon; interferon epsilon 1; interferon epsilon-1; IFN-E; IFNT1; PRO655; MGC119018; MGC119020
• Gene ID: 338376
• mRNA Refseq: NM_176891
• Protein Refseq: NP_795372
• MIM: 615223
• UniProt ID: Q86WN2
• Chromosome Location: 9p21.1
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem
• Function: cytokine activity; cytokine receptor binding