Recombinant Mouse IFNE Protein (22-192 aa), His-SUMO-tagged

Cat.No. : IFNE-1057M
Product Overview : Recombinant Mouse IFNE Protein (22-192 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 22-192 aa
Description : Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 36.0 kDa
AA Sequence : LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Ifne interferon epsilon [ Mus musculus ]
Official Symbol IFNE
Synonyms IFNE; IFN-epsilon; Ifne1; Ifnt1; Infe1; Ifn-tau-1; RP23-400P11.1; MGC129462; MGC129463;
Gene ID 230405
mRNA Refseq NM_177348
Protein Refseq NP_796322
UniProt ID Q80ZF2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFNE Products

Required fields are marked with *

My Review for All IFNE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon