Recombinant Human IFNB1 protein

• Cat.No.: IFNB1-08H
• Product Overview: Recombinant Human IFNB1 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 166
• Description: IFN-βs are proteins produced by many cell types including lymphocytes (NK cells, B-cells and T-cells), macrophages, fibroblasts, endothelial cells, osteoblasts and others. They have antiviral activity that it is mainly involved in innate immune response. The IFN-β family has 2 subtypes，which are IFN-β1 (IFNB1) and IFN-β3 (IFNB3) (a gene designated IFN-β2 is actually IL-6). IFN-β1 is used as a treatment for multiple sclerosis as it reduces the relapse rate.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, containing 2 % HSA and 3 % mannitol.
• Bio-activity: Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 3.0 × 10⁷ IU/mg.
• Molecular Mass: Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids.
• AA Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
• Endotoxin: Less than 1 EU/µg of rHuIFN-β1b as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IFNB1
• Official Symbol: IFNB1
• Synonyms: IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956
• Gene ID: 3456
• mRNA Refseq: NM_002176
• Protein Refseq: NP_002167
• MIM: 147640
• UniProt ID: P01574