Recombinant Mouse IFNB1 Protein

• Cat.No.: IFNB1-496M
• Product Overview: Recombinant Mouse IFNB1 protein

Specification

• Species: Mouse
• Protein Length: 182
• Description: Enables cytokine activity and type I interferon receptor binding activity. Involved in B cell proliferation; cellular response to virus; and type I interferon signaling pathway. Acts upstream of or within several processes, including cellular response to organic cyclic compound; defense response to other organism; and negative regulation of osteoclast differentiation. Located in extracellular space. Is expressed in embryo and liver. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human IFNB1 (interferon beta 1).
• Form: Lyophilized
• AA Sequence: MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Ifnb1 interferon beta 1, fibroblast [ Mus musculus (house mouse) ]
• Official Symbol: IFNB1
• Synonyms: IFNB1; interferon beta 1, fibroblast; interferon beta; Ifb; IFNB; IFN-beta
• Gene ID: 15977
• mRNA Refseq: NM_010510
• Protein Refseq: NP_034640
• UniProt ID: P01575