Recombinant Human IFNA14 Protein, His-SUMO-tagged

• Cat.No.: IFNA14-1253H
• Product Overview: Recombinant Human IFNA14 Protein (24-189aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 35.7 kDa
• AA Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFST
  KNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCA
  WEVVRAEIMRSLSFSTNLQKRLRRKD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 24-189 a.a.

Gene Information

• Gene Name: IFNA14 interferon, alpha 14 [ Homosapiens ]
• Official Symbol: IFNA14
• Synonyms: IFNA14; interferon, alpha 14; LEIF2H;MGC125756; MGC125757; interferon alpha 14; interferon alpha-14; Interferonalpha-H; Interferon lambda-2-H; LeIF H; IFN-alpha-14; OTTHUMP00000021139
• Gene ID: 3448
• mRNA Refseq: NM_002172
• Protein Refseq: NP_002163
• MIM: 147579
• UniProt ID: P01570