Recombinant Human IFNA14 Protein, His-SUMO-tagged

Cat.No. : IFNA14-1253H
Product Overview : Recombinant Human IFNA14 Protein (24-189aa) was expressed in E. coli with N-terminal His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 24-189 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 35.7 kDa
AA Sequence : CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFST
KNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCA
WEVVRAEIMRSLSFSTNLQKRLRRKD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name IFNA14 interferon, alpha 14 [ Homosapiens ]
Official Symbol IFNA14
Synonyms IFNA14; interferon, alpha 14; LEIF2H;MGC125756; MGC125757; interferon alpha 14; interferon alpha-14; Interferonalpha-H; Interferon lambda-2-H; LeIF H; IFN-alpha-14; OTTHUMP00000021139
Gene ID 3448
mRNA Refseq NM_002172
Protein Refseq NP_002163
MIM 147579
UniProt ID P01570

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFNA14 Products

Required fields are marked with *

My Review for All IFNA14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon