Recombinant Human IFNA14 protein, GST-tagged

• Cat.No.: IFNA14-3068H
• Product Overview: Recombinant Human IFNA14 protein(P01570)(24-189aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.7 kDa
• Protein length: 24-189aa
• AA Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: IFNA14 interferon, alpha 14 [ Homo sapiens ]
• Official Symbol: IFNA14
• Synonyms: IFNA14; interferon, alpha 14; interferon alpha-14; IFN alphaH; LEIF2H; leIF H; IFN-alpha-14; interferon alpha-H; interferon lambda-2-H; IFN-alphaH; MGC125756; MGC125757
• Gene ID: 3448
• mRNA Refseq: NM_002172
• Protein Refseq: NP_002163
• MIM: 147579
• UniProt ID: P01570