Recombinant Human HYAL4 Protein, GST-tagged

• Cat.No.: HYAL4-5218H
• Product Overview: Human HYAL4 partial ORF ( NP_036401.1, 357 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: FVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGKASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HYAL4 hyaluronoglucosaminidase 4 [ Homo sapiens ]
• Official Symbol: HYAL4
• Synonyms: HYAL4; hyaluronoglucosaminidase 4; hyaluronidase-4; hyaluronidase 4; hyal-4; hyaluronoglucosaminidase-4; chondroitin sulfate hydrolase; CSHY
• Gene ID: 23553
• mRNA Refseq: NM_012269
• Protein Refseq: NP_036401
• MIM: 604510
• UniProt ID: Q2M3T9