Recombinant Human HYAL2 Protein, GST-tagged

• Cat.No.: HYAL2-5221H
• Product Overview: Human HYAL2 partial ORF ( NP_003764, 340 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. Varying functions have been described for this protein. It has been described as a lysosomal hyaluronidase which is active at a pH below 4 and specifically hydrolyzes high molecular weight hyaluronan. It has also been described as a GPI-anchored cell surface protein which does not display hyaluronidase activity but does serve as a receptor for the oncogenic virus Jaagsiekte sheep retrovirus. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. This gene encodes two alternatively spliced transcript variants which differ only in the 5 UTR. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: CQYLKDYLTRLLVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDHLQTHFRCQCYLGWSGEQCQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HYAL2 hyaluronoglucosaminidase 2 [ Homo sapiens ]
• Official Symbol: HYAL2
• Synonyms: HYAL2; hyaluronoglucosaminidase 2; hyaluronidase-2; hyaluronidase 2; LuCa 2; LUCA2; lysosomal hyaluronidase; PH 20 homolog; hyal-2; PH20 homolog; PH-20 homolog; lung carcinoma protein 2; hyaluronoglucosaminidase-2
• Gene ID: 8692
• mRNA Refseq: NM_003773
• Protein Refseq: NP_003764
• MIM: 603551
• UniProt ID: Q12891