Recombinant Human HTR1E Protein, GST-tagged

• Cat.No.: HTR1E-5247H
• Product Overview: Human HTR1E full-length ORF ( NP_000856, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HTR1E (5-Hydroxytryptamine Receptor 1E) is a Protein Coding gene. Diseases associated with HTR1E include Attention Deficit-Hyperactivity Disorder. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1F.
• Molecular Mass: 65.67 kDa
• AA Sequence: MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HTR1E 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [ Homo sapiens ]
• Official Symbol: HTR1E
• Synonyms: HTR1E; 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1E; 5-hydroxytryptamine receptor 1E; 5 HT1E; S31; 5-HT-1E; serotonin receptor 1E; 5-HT1E
• Gene ID: 3354
• mRNA Refseq: NM_000865
• Protein Refseq: NP_000856
• MIM: 182132
• UniProt ID: P28566