Recombinant Human HTR1E Protein
Cat.No. : | HTR1E-5248H |
Product Overview : | Human HTR1E full-length ORF (NP_000856.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | HTR1E (5-Hydroxytryptamine Receptor 1E) is a Protein Coding gene. Diseases associated with HTR1E include Attention Deficit-Hyperactivity Disorder. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1F. |
Form : | Liquid |
Molecular Mass : | 41.7 kDa |
AA Sequence : | MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | HTR1E 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR1E |
Synonyms | HTR1E; 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1E; 5-hydroxytryptamine receptor 1E; 5 HT1E; S31; 5-HT-1E; serotonin receptor 1E; 5-HT1E; |
Gene ID | 3354 |
mRNA Refseq | NM_000865 |
Protein Refseq | NP_000856 |
MIM | 182132 |
UniProt ID | P28566 |
◆ Cell & Tissue Lysates | ||
HTR1E-5336HCL | Recombinant Human HTR1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR1E Products
Required fields are marked with *
My Review for All HTR1E Products
Required fields are marked with *
0
Inquiry Basket