Recombinant Human HSD11B1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HSD11B1-1415H
Product Overview : HSD11B1 MS Standard C13 and N15-labeled recombinant protein (NP_861420) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.
Molecular Mass : 32.4 kDa
AA Sequence : MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HSD11B1 hydroxysteroid 11-beta dehydrogenase 1 [ Homo sapiens (human) ]
Official Symbol HSD11B1
Synonyms HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1; short chain dehydrogenase/reductase family 26C, member 1; HDL; 11-DH; HSD11; HSD11B; HSD11L; 11-beta-HSD1; MGC13539;
Gene ID 3290
mRNA Refseq NM_181755
Protein Refseq NP_861420
MIM 600713
UniProt ID P28845

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSD11B1 Products

Required fields are marked with *

My Review for All HSD11B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon