Recombinant Human HSD11B1

Description :	The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.
Protein length :	292 amino acids
Molecular Weight :	57.860kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Widely expressed. Highest expression in liver.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVT GASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE LGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ SNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY STSYNMDRFINK
Sequence Similarities :	Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Tag :	Non

Gene Name	HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ]
Official Symbol	HSD11B1
Synonyms	HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1;
Gene ID	3290
mRNA Refseq	NM_001206741
Protein Refseq	NP_001193670
MIM	600713
Uniprot ID	P28845
Chromosome Location	1q32-q41
Pathway	Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone, organism-specific biosystem; C21-Steroid hormone biosynthesis, progesterone =>
Function	11-beta-hydroxysteroid dehydrogenase (NADP+) activity; 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity; nucleotide binding; oxidoreductase activity;

COA

Cat.No. :	HSD11B1-27736TH
Product Overview :	Recombinant full length protein, corresponding to amino acids 1-292 of Human HSD11B1, with an N-terminal proprietary tag, predicted MWt 57.86 kDa