Recombinant Human HS3ST1 Protein, GST-tagged

Cat.No. : HS3ST1-5049H
Product Overview : Human HS3ST1 full-length ORF ( NP_005105.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq
Molecular Mass : 62.2 kDa
AA Sequence : MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HS3ST1 heparan sulfate (glucosamine) 3-O-sulfotransferase 1 [ Homo sapiens ]
Official Symbol HS3ST1
Synonyms HS3ST1; heparan sulfate (glucosamine) 3-O-sulfotransferase 1; heparan sulfate glucosamine 3-O-sulfotransferase 1; 3OST1; 3-OST-1; h3-OST-1; heparan sulfate 3-O-sulfotransferase 1; heparin-glucosamine 3-O-sulfotransferase; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1; 3OST;
Gene ID 9957
mRNA Refseq NM_005114
Protein Refseq NP_005105
MIM 603244
UniProt ID O14792

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HS3ST1 Products

Required fields are marked with *

My Review for All HS3ST1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon