Recombinant Human HOXB13 Protein, His-tagged

• Cat.No.: HOXB13-41H
• Product Overview: Recombinant Human HOXB13 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin development and cutaneous regeneration. In mice, a similar gene was shown to exhibit temporal and spatial colinearity in the main body axis of the embryo, but was not expressed in the secondary axes, which suggests functions in body patterning along the axis. This gene and other HOXB genes form a gene cluster at chromosome the 17q21-22 region.
• Form: 50 mM Tris, 0.3 M NaCl, pH 8.0.
• Molecular Mass: 33.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP
• Purity: ＞95%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.25 mg/mL

Gene Information

• Gene Name: HOXB13 homeobox B13 [ Homo sapiens (human) ]
• Official Symbol: HOXB13
• Synonyms: HPC9; PSGD
• Gene ID: 10481
• mRNA Refseq: NM_006361
• Protein Refseq: NP_006352
• MIM: 604607
• UniProt ID: Q92826