Recombinant Human HOXB13 protein, GST-tagged

• Cat.No.: HOXB13-4903H
• Product Overview: Recombinant Human HOXB13(1 a.a. - 284 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-284 a.a.
• Description: This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin development and cutaneous regeneration. In mice, a similar gene was shown to exhibit temporal and spatial colinearity in the main body axis of the embryo, but was not expressed in the secondary axes, which suggests functions in body patterning along the axis. This gene and other HOXB genes form a gene cluster at chromosome the 17q21-22 region.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 56.98 kDa
• AA Sequence: MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSP APVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQ TLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSK GQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: HOXB13 homeobox B13 [ Homo sapiens ]
• Official Symbol: HOXB13
• Synonyms: HOXB13; homeobox B13; homeo box B13; homeobox protein Hox-B13; PSGD
• Gene ID: 10481
• mRNA Refseq: NM_006361
• Protein Refseq: NP_006352
• MIM: 604607
• UniProt ID: Q92826
• Chromosome Location: 17q21.32
• Pathway: Regulation of Androgen receptor activity, organism-specific biosystem
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity