Recombinant Human HNRNPA2B1 protein(11-320 aa), C-His-tagged

Cat.No. : HNRNPA2B1-2699H
Product Overview : Recombinant Human HNRNPA2B1 protein(P22626)(11-320 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-320 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 36 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : ERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGN
Gene Name HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Homo sapiens ]
Official Symbol HNRNPA2B1
Synonyms HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; HNRPA2B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2 / hnRNP B1; nuclear ribonucleoprotein particle A2 protein; RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; FLJ22720; DKFZp779B0244;
Gene ID 3181
mRNA Refseq NM_002137
Protein Refseq NP_002128
MIM 600124
UniProt ID P22626

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HNRNPA2B1 Products

Required fields are marked with *

My Review for All HNRNPA2B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon