Recombinant Human HNRNPA2B1 protein, His&Myc-tagged
Cat.No. : | HNRNPA2B1-786H |
Product Overview : | Recombinant Human HNRNPA2B1 protein(P22626)(1-353aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Species : | Human |
Tag : | N-His&C-Myc |
Protein length : | 1-353aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.9 kDa |
AASequence : | MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Homo sapiens ] |
Official Symbol | HNRNPA2B1 |
Synonyms | HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; HNRPA2B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2 / hnRNP B1; nuclear ribonucleoprotein particle A2 protein; RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; FLJ22720; DKFZp779B0244; |
Gene ID | 3181 |
mRNA Refseq | NM_002137 |
Protein Refseq | NP_002128 |
MIM | 600124 |
UniProt ID | P22626 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HNRNPA2B1 Products
Required fields are marked with *
My Review for All HNRNPA2B1 Products
Required fields are marked with *
0
Inquiry Basket