Recombinant Human HMGN4 Protein, GST-tagged

• Cat.No.: HMGN4-4882H
• Product Overview: Human HMGN4 full-length ORF ( AAH01282, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq
• Molecular Mass: 35.64 kDa
• AA Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMGN4 high mobility group nucleosomal binding domain 4 [ Homo sapiens ]
• Official Symbol: HMGN4
• Synonyms: HMGN4; high mobility group nucleosomal binding domain 4; high mobility group (nonhistone chromosomal) protein 17 like 3 , HMG17L3; high mobility group nucleosome-binding domain-containing protein 4; NHC; high mobility group protein N4; high-mobility group protein 17-like 3; non-histone chromosomal protein HMG-17-like 3; high-mobility group (nonhistone chromosomal) protein 17-like 3; HMG17L3; MGC5145
• Gene ID: 10473
• mRNA Refseq: NM_006353
• Protein Refseq: NP_006344
• UniProt ID: O00479