Recombinant Human HMGN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HMGN4-2523H
• Product Overview: HMGN4 MS Standard C13 and N15-labeled recombinant protein (NP_006344) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates.
• Molecular Mass: 9.5 kDa
• AA Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HMGN4 high mobility group nucleosomal binding domain 4 [ Homo sapiens (human) ]
• Official Symbol: HMGN4
• Synonyms: HMGN4; high mobility group nucleosomal binding domain 4; high mobility group (nonhistone chromosomal) protein 17 like 3, HMG17L3; high mobility group nucleosome-binding domain-containing protein 4; NHC; high mobility group protein N4; high-mobility group protein 17-like 3; non-histone chromosomal protein HMG-17-like 3; high-mobility group (nonhistone chromosomal) protein 17-like 3; HMG17L3; MGC5145
• Gene ID: 10473
• mRNA Refseq: NM_006353
• Protein Refseq: NP_006344
• UniProt ID: O00479