Recombinant Full Length Human HMGN4 Protein, GST-tagged

Cat.No. : HMGN4-3662HF
Product Overview : Human HMGN4 full-length ORF ( AAH01282, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 90 amino acids
Description : The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq
Molecular Mass : 35.64 kDa
AA Sequence : MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMGN4 high mobility group nucleosomal binding domain 4 [ Homo sapiens ]
Official Symbol HMGN4
Synonyms HMGN4; high mobility group nucleosomal binding domain 4; high mobility group (nonhistone chromosomal) protein 17 like 3 , HMG17L3; high mobility group nucleosome-binding domain-containing protein 4; NHC; high mobility group protein N4; high-mobility group protein 17-like 3; non-histone chromosomal protein HMG-17-like 3; high-mobility group (nonhistone chromosomal) protein 17-like 3; HMG17L3; MGC5145;
Gene ID 10473
mRNA Refseq NM_006353
Protein Refseq NP_006344
UniProt ID O00479

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HMGN4 Products

Required fields are marked with *

My Review for All HMGN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon