Recombinant Human HMGB1 protein(81-200 aa), C-His-tagged

• Cat.No.: HMGB1-2613H
• Product Overview: Recombinant Human HMGB1 protein(P09429)(81-200 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Product Overview: Recombinant Human HMGB1 protein(P09429)(81-200 aa), fused with C-terminal His tag, was expressed in E. coli.
• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 81-200 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: HMGB1 high mobility group box 1 [ Homo sapiens ]
• Official Symbol: HMGB1
• Synonyms: HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1
• Gene ID: 3146
• mRNA Refseq: NM_002128
• Protein Refseq: NP_002119
• MIM: 163905
• UniProt ID: P09429