Recombinant Human HLA-G protein, His-B2M-tagged

• Cat.No.: HLA-G-4305H
• Product Overview: Recombinant Human HLA-G protein(P17693)(25-308aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 25-308aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.2 kDa
• AA Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• Publications:
  BiTE-Secreting CAR-γδT as a Dual Targeting Strategy for the Treatment of Solid Tumors (2023)
  Targeting Dual Immune Checkpoints PD-L1 and HLA-G by Trispecific T Cell Engager for Treating Heterogeneous Lung Cancer (2024)

Gene Information

• Gene Name: HLA-G major histocompatibility complex, class I, G [ Homo sapiens ]
• Official Symbol: HLA-G
• Synonyms: HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G
• Gene ID: 3135
• mRNA Refseq: NM_002127
• Protein Refseq: NP_002118
• MIM: 142871
• UniProt ID: P17693