Recombinant Human HLA-G Protein, Fc tagged

• Cat.No.: HLA-G-1242H
• Product Overview: Recombinant Human HLA-G Protein with Fc tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Fc&Non
• Description: HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail.
• Molecular Mass: 65.2 kDa
• AA Sequence: MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSDLEVLFQGPEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: < 1.0 EU/μg by LAL
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade. Avoid freeze/thaw cycles.
• Storage Buffer: Sterile PBS, pH 7.4
• Concentration: 0.76 mg/mL

Gene Information

• Gene Name: HLA-G major histocompatibility complex, class I, G [ Homo sapiens (human) ]
• Official Symbol: HLA-G
• Synonyms: HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G
• Gene ID: 3135
• mRNA Refseq: NM_002127
• Protein Refseq: NP_002118
• MIM: 142871
• UniProt ID: P17693