Recombinant Human HLA-E protein, His-tagged

• Cat.No.: HLA-E-3399H
• Product Overview: Recombinant Human HLA-E protein(23-303 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-303 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: HLA-E major histocompatibility complex, class I, E [ Homo sapiens ]
• Official Symbol: HLA-E
• Synonyms: HLA-E; major histocompatibility complex, class I, E; HLA class I histocompatibility antigen, alpha chain E; MHC HLA-E alpha-1; lymphocyte antigen; MHC HLA-E alpha-2.1; MHC class I antigen E; HLA class I histocompatibility antigen, E alpha chain; MHC; QA1; EA1.2; EA2.1; HLA-6.2; DKFZp686P19218
• Gene ID: 3133
• mRNA Refseq: NM_005516
• Protein Refseq: NP_005507
• MIM: 143010
• UniProt ID: P13747