Recombinant Human HLA-E protein, His-tagged
Cat.No. : | HLA-E-3399H |
Product Overview : | Recombinant Human HLA-E protein(23-303 aa), fused to His tag, was expressed in E. coli. |
Availability | April 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-303 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HLA-E major histocompatibility complex, class I, E [ Homo sapiens ] |
Official Symbol | HLA-E |
Synonyms | HLA-E; major histocompatibility complex, class I, E; HLA class I histocompatibility antigen, alpha chain E; MHC HLA-E alpha-1; lymphocyte antigen; MHC HLA-E alpha-2.1; MHC class I antigen E; HLA class I histocompatibility antigen, E alpha chain; MHC; QA1; EA1.2; EA2.1; HLA-6.2; DKFZp686P19218; |
Gene ID | 3133 |
mRNA Refseq | NM_005516 |
Protein Refseq | NP_005507 |
MIM | 143010 |
UniProt ID | P13747 |
◆ Recombinant Proteins | ||
HLA-E-039H | Recombinant Human HLA-E protein, His-Avi-tagged, Biotinylated | +Inquiry |
HLA-E-040HP | Recombinant Human HLA-E complex Protein (tetramer), His-Avi-tagged, PE-Labeled | +Inquiry |
HLA-E-3399H | Recombinant Human HLA-E protein, His-tagged | +Inquiry |
HLA-E-1746H | Recombinant Human HLA-E protein, His-tagged | +Inquiry |
HLA-E-268HFL | Recombinant Full Length Human HLA-E Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-E-800HCL | Recombinant Human HLA-E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-E Products
Required fields are marked with *
My Review for All HLA-E Products
Required fields are marked with *
0
Inquiry Basket