Recombinant Human HLA-DRB5, His-tagged

• Cat.No.: HLA-DRB5-104H
• Product Overview: Recombinant Human HLA Class II Histocompatibility Antigen DR β 5 Chain/HLA-DRB5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly30-Lys227) of Human HLA-DRB5 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 30-227 a.a.
• Description: HLA Class II Histocompatibility Antigen DR β 5 Chain (HLA-DRB5) is a single-pass type I membrane protein that belongs to the MHC class II family. HLA-DRB5 contains one Ig-like C1-type domain. The class II molecule is a heterodimer consisting of an α (DRA) and a β chain (DRB), both anchored in the membrane. HLA-DRB5 plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. Within the DR molecule, the β chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. The presence of DRB5 is linked with allelic variants of DRB1, otherwise it is omitted.
• AA Sequence: GDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQK DFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVR WFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESA QSKVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: HLA-DRB5 major histocompatibility complex, class II, DR beta 5 [ Homo sapiens ]
• Official Symbol: HLA-DRB5
• Synonyms: HLA-DRB5; major histocompatibility complex, class II, DR beta 5; HLA-DRB
• Gene ID: 731247
• Pathway: Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Downstream TCR signaling, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem