Recombinant Human HLA-DQB1 protein, His-tagged
Cat.No. : | HLA-DQB1-4097H |
Product Overview : | Recombinant Human HLA-DQB1 protein(P01920)(33-227aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 33-227aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27 kDa |
AA Sequence : | RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HLA-DQB1 major histocompatibility complex, class II, DQ beta 1 [ Homo sapiens ] |
Official Symbol | HLA-DQB1 |
Synonyms | HLA-DQB1; major histocompatibility complex, class II, DQ beta 1; HLA DQB; HLA class II histocompatibility antigen, DQ beta 1 chain; CELIAC1; IDDM1; MHC DQ beta; MHC class2 antigen; lymphocyte antigen; MHC class II antigen DQB1; MHC class II DQ beta chain; MHC class II antigen HLA-DQ-beta-1; MHC class II HLA-DQ beta glycoprotein; HLA-DQB; |
Gene ID | 3119 |
mRNA Refseq | NM_001243961 |
Protein Refseq | NP_001230890 |
MIM | 604305 |
UniProt ID | P01920 |
◆ Recombinant Proteins | ||
HLA-DQB1-802H | Recombinant Human HLA-DQB1 protein, GST-tagged | +Inquiry |
HLA-DQB1-683HF | Recombinant Full Length Human HLA-DQB1 Protein, GST-tagged | +Inquiry |
HLA-DQB1-27714TH | Recombinant Human HLA-DQB1 | +Inquiry |
HLA-DQB1-4097H | Recombinant Human HLA-DQB1 protein, His-tagged | +Inquiry |
HLA-DQB1-12H | Recombinant Human HLA-DQB1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DQB1-5496HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-DQB1 Products
Required fields are marked with *
My Review for All HLA-DQB1 Products
Required fields are marked with *
0
Inquiry Basket