Recombinant Human HLA-DQB1 protein, His-tagged

• Cat.No.: HLA-DQB1-4097H
• Product Overview: Recombinant Human HLA-DQB1 protein(P01920)(33-227aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 33-227aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27 kDa
• AA Sequence: RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HLA-DQB1 major histocompatibility complex, class II, DQ beta 1 [ Homo sapiens ]
• Official Symbol: HLA-DQB1
• Synonyms: HLA-DQB1; major histocompatibility complex, class II, DQ beta 1; HLA DQB; HLA class II histocompatibility antigen, DQ beta 1 chain; CELIAC1; IDDM1; MHC DQ beta; MHC class2 antigen; lymphocyte antigen; MHC class II antigen DQB1; MHC class II DQ beta chain; MHC class II antigen HLA-DQ-beta-1; MHC class II HLA-DQ beta glycoprotein; HLA-DQB
• Gene ID: 3119
• mRNA Refseq: NM_001243961
• Protein Refseq: NP_001230890
• MIM: 604305
• UniProt ID: P01920