Recombinant Human HLA-DMA protein, His-tagged

• Cat.No.: HLA-DMA-4026H
• Product Overview: Recombinant Human HLA-DMA protein(Q6ICR9)(27-233aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 27-233aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.4 kDa
• AA Sequence: VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HLA-DMA major histocompatibility complex, class II, DM alpha [ Homo sapiens ]
• Official Symbol: HLA-DMA
• Synonyms: HLA-DMA; major histocompatibility complex, class II, DM alpha; HLA class II histocompatibility antigen, DM alpha chain; D6S222E; RING6; MHC class II antigen DMA; really interesting new gene 6 protein; class II histocompatibility antigen, M alpha chain; DMA; HLADM
• Gene ID: 3108
• mRNA Refseq: NM_006120
• Protein Refseq: NP_006111
• MIM: 142855
• UniProt ID: P28067