Recombinant Human HisT4H4, His-tagged

• Cat.No.: HIST4H4-29325TH
• Product Overview: Recombinant full length Human Histone H4 with a proprietary tag; Predicted MWt 37.44 kDa including tag.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.
• Protein length: 103 amino acids
• Conjugation: HIS
• Molecular Weight: 37.440kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Gene Information

• Gene Name: HIST4H4 histone cluster 4, H4 [ Homo sapiens ]
• Official Symbol: HIST4H4
• Synonyms: HIST4H4; histone cluster 4, H4; histone 4, H4; histone H4; MGC24116
• Gene ID: 121504
• mRNA Refseq: NM_175054
• Protein Refseq: NP_778224
• Uniprot ID: P62805
• Chromosome Location: 12p12.3
• Pathway: Amyloids, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Recombination, organism-specific biosystem