Recombinant Full Length Human HIST4H4 Protein, GST-tagged
Cat.No. : | HIST4H4-3607HF |
Product Overview : | Human HIST4H4 full-length ORF ( AAH20884, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 103 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. [provided by RefSeq |
Molecular Mass : | 37.07 kDa |
AA Sequence : | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST4H4 histone cluster 4, H4 [ Homo sapiens ] |
Official Symbol | HIST4H4 |
Synonyms | HIST4H4; histone cluster 4, H4; histone 4, H4; histone H4; MGC24116; H4/p; HIST1H4A; HIST1H4B; HIST1H4C; HIST1H4D; HIST1H4E; HIST1H4F; HIST1H4H; HIST1H4I; HIST1H4J; HIST1H4K; HIST1H4L; HIST2H4A; HIST2H4B; |
Gene ID | 121504 |
mRNA Refseq | NM_175054 |
Protein Refseq | NP_778224 |
MIM | 615069 |
UniProt ID | P62805 |
◆ Recombinant Proteins | ||
HIST4H4-29325TH | Recombinant Human HisT4H4, His-tagged | +Inquiry |
HIST4H4-401H | Recombinant Human HIST4H4 Protein, MYC/DDK-tagged | +Inquiry |
HIST4H4-229HF | Recombinant Full Length Human HisT4H4 Protein, His-tagged | +Inquiry |
HIST4H4-4819H | Recombinant Human HIST4H4 Protein, GST-tagged | +Inquiry |
HIST4H4-490H | Recombinant Human HIST4H4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST4H4-5510HCL | Recombinant Human HIST4H4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST4H4 Products
Required fields are marked with *
My Review for All HIST4H4 Products
Required fields are marked with *
0
Inquiry Basket