Recombinant Human HINT2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HINT2-4767H
• Product Overview: HINT2 MS Standard C13 and N15-labeled recombinant protein (NP_115982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17.2 kDa
• AA Sequence: MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HINT2 histidine triad nucleotide binding protein 2 [ Homo sapiens (human) ]
• Official Symbol: HINT2
• Synonyms: HINT2; histidine triad nucleotide binding protein 2; histidine triad nucleotide-binding protein 2, mitochondrial; HINT-2; HINT-3; HIT-17kDa; PKCI-1-related HIT protein; protein kinase C inhibitor-2; HIT-17
• Gene ID: 84681
• mRNA Refseq: NM_032593
• Protein Refseq: NP_115982
• MIM: 609997
• UniProt ID: Q9BX68