Recombinant Human HINT2 Protein, GST-tagged

• Cat.No.: HINT2-4752H
• Product Overview: Human HINT2 full-length ORF ( NP_115982.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 43.6 kDa
• AA Sequence: MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HINT2 histidine triad nucleotide binding protein 2 [ Homo sapiens ]
• Official Symbol: HINT2
• Synonyms: HINT2; histidine triad nucleotide binding protein 2; histidine triad nucleotide-binding protein 2, mitochondrial; HINT-2; HINT-3; HIT-17kDa; PKCI-1-related HIT protein; protein kinase C inhibitor-2; HIT-17
• Gene ID: 84681
• mRNA Refseq: NM_032593
• Protein Refseq: NP_115982
• MIM: 609997
• UniProt ID: Q9BX68