Recombinant Human HDAC2 protein, His-tagged

• Cat.No.: HDAC2-13708H
• Product Overview: Recombinant Human HDAC2(NP_001518.3)(Met1~Pro488), fused with N-terminal His Tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Met1~Pro488
• Description: This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants.
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose.
• Molecular Mass: 60kDa as determined by SDS-PAGE reducing conditions.
• AA Sequence: MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
• Endotoxin: < 1.0EU per 1µg (determined by the LAL method)
• Purity: > 90%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
  If bio-activity of the protein is needed, please check active protein.
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
• Concentration: 200µg/mL
• Reconstitution: Reconstitute in ddH2O to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: HDAC2 histone deacetylase 2 [ Homo sapiens (human) ]
• Official Symbol: HDAC2
• Synonyms: HD2; RPD3; YAF1; KDAC2
• Gene ID: 3066
• mRNA Refseq: NM_001527.4
• Protein Refseq: NP_001518.3
• MIM: 605164
• UniProt ID: Q92769