Recombinant Human HDAC2 Protein, His-tagged

• Cat.No.: HDAC2-4642H
• Product Overview: Human HDAC2 (NP_001518, 1 a.a. - 488 a.a.) full-length recombinant protein with His tag expressed in Hi-5 cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Description: This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes and are responsible for the deacetylation of lysine residues on the N-terminal region of the core histones (H2A, H2B, H3 and H4). This protein also forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus it plays an important role in transcriptional regulation, cell cycle progression and developmental events. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 56.4 kDa
• AA Sequence: MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNPSRHHHHHH
• Purity: > 85% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -2 centigrade or -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM PMSF, pH 8.0 (20% glycerol, 1 mM dithiothreitol)

Gene Information

• Gene Name: HDAC2 histone deacetylase 2 [ Homo sapiens ]
• Official Symbol: HDAC2
• Synonyms: HDAC2; histone deacetylase 2; RPD3; YAF1; YY1-associated factor 1; transcriptional regulator homolog RPD3; HD2
• Gene ID: 3066
• mRNA Refseq: NM_001527
• Protein Refseq: NP_001518
• MIM: 605164
• UniProt ID: Q92769