Recombinant Human H2AFY protein, T7/His-tagged

Cat.No. : H2AFY-117H
Product Overview : Recombinant human H2AFY gene (derived from BC095406) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPV YMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKG KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKL NLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKF VIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIK TVYFVLFDSESIGIYVQEMAKLDAN
Purity : >90% by SDS-PAGE
Applications : 1. May be used as specific substrate protein for kinase enzymatic assay.2. May be used for in vitro histone/DNA reconstitution assay.3. May be used as native immunogen for specific antibody production.4. May be used as protein biomarker for Huntinton disease monitoring.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name H2AFY H2A histone family, member Y [ Homo sapiens ]
Official Symbol H2AFY
Synonyms H2AFY; H2A histone family, member Y; core histone macro-H2A.1; macroH2A1.2; histone H2A.y
Gene ID 9555
mRNA Refseq NM_001040158
Protein Refseq NP_001035248
MIM 610054
UniProt ID O75367
Chromosome Location 5q31.1
Pathway ATF-2 transcription factor network, organism-specific biosystem; Systemic lupus erythematosus, organism-specific biosystem; Systemic lupus erythematosus, conserved biosystem;
Function DNA binding; chromatin binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All H2AFY Products

Required fields are marked with *

My Review for All H2AFY Products

Required fields are marked with *

0

Inquiry Basket

cartIcon