Recombinant Human H2AFX protein, GST-tagged

• Cat.No.: H2AFX-68H
• Product Overview: Recombinant Human H2AFX (1 a.a. - 96 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-96 a.a.
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.19 kDa
• AA Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK KTRIIPRHLQLAIRNDEELNK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: H2AFX H2A histone family, member X [ Homo sapiens ]
• Official Symbol: H2AFX
• Synonyms: H2AX; H2A.X; H2A/X; histone H2AX; H2AX histone; histone H2A.x
• Gene ID: 3014
• mRNA Refseq: NM_002105
• Protein Refseq: NP_002096
• MIM: 601772
• UniProt ID: P16104
• Chromosome Location: 11q23.3
• Pathway: ATM mediated phosphorylation of repair proteins, organism-specific biosystem; ATM mediated response to DNA double-strand break, organism-specific biosystem; Alcoholism, organism-specific biosystem
• Function: DNA binding; damaged DNA binding; enzyme binding