Recombinant Human GZMH Protein, GST-tagged

Cat.No. : GZMH-4521H
Product Overview : Human GZMH full-length ORF ( NP_219491.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the peptidase S1 family of serine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a chymotrypsin-like protease. This protein is reported to be constitutively expressed in the NK (natural killer) cells of the immune system and may play a role in the cytotoxic arm of the innate immune response by inducing target cell death and by directly cleaving substrates in pathogen-infected cells. This gene is present in a gene cluster with another member of the granzyme subfamily on chromosome 14. [provided by RefSeq, Nov 2015]
Molecular Mass : 53.7 kDa
AA Sequence : MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GZMH granzyme H (cathepsin G-like 2, protein h-CCPX) [ Homo sapiens ]
Official Symbol GZMH
Synonyms GZMH; granzyme H (cathepsin G-like 2, protein h-CCPX); CTSGL2; granzyme H; CCP X; CGL 2; CSP C; CTLA1; cathepsin G-like 2; cytotoxic serine protease C; cytotoxin serine protease-C; cytotoxic T-lymphocyte proteinase; cytotoxic T-lymphocyte-associated serine esterase 1; CCP-X; CGL-2; CSP-C;
Gene ID 2999
mRNA Refseq NM_033423
Protein Refseq NP_219491
MIM 116831
UniProt ID P20718

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GZMH Products

Required fields are marked with *

My Review for All GZMH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon