Recombinant Full Length Human GZMH Protein, GST-tagged

• Cat.No.: GZMH-3390HF
• Product Overview: Human GZMH full-length ORF ( NP_219491.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the peptidase S1 family of serine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a chymotrypsin-like protease. This protein is reported to be constitutively expressed in the NK (natural killer) cells of the immune system and may play a role in the cytotoxic arm of the innate immune response by inducing target cell death and by directly cleaving substrates in pathogen-infected cells. This gene is present in a gene cluster with another member of the granzyme subfamily on chromosome 14. [provided by RefSeq, Nov 2015]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 53.7 kDa
• Protein length: 246 amino acids
• AA Sequence: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GZMH granzyme H (cathepsin G-like 2, protein h-CCPX) [ Homo sapiens ]
• Official Symbol: GZMH
• Synonyms: GZMH; granzyme H (cathepsin G-like 2, protein h-CCPX); CTSGL2; granzyme H; CCP X; CGL 2; CSP C; CTLA1; cathepsin G-like 2; cytotoxic serine protease C; cytotoxin serine protease-C; cytotoxic T-lymphocyte proteinase; cytotoxic T-lymphocyte-associated serine esterase 1; CCP-X; CGL-2; CSP-C
• Gene ID: 2999
• mRNA Refseq: NM_033423
• Protein Refseq: NP_219491
• MIM: 116831
• UniProt ID: P20718