Recombinant Human GYS1, GST-tagged
Cat.No. : | GYS1-12H |
Product Overview : | Recombinant Human GYS1(1 a.a. - 737 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1,4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 106.59 kDa |
AA Sequence : | MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRT QVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREAND AVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLE NFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNF NVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLD DSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIP SISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSPDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERY DEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GYS1 glycogen synthase 1 (muscle) [ Homo sapiens (human) ] |
Official Symbol | GYS1 |
Synonyms | GYS1; GSY; GYS; glycogen synthase 1 (muscle); glycogen [starch] synthase, muscle; NP_001155059.1; EC 2.4.1.11; NP_002094.2 |
Gene ID | 2997 |
mRNA Refseq | NM_002103 |
Protein Refseq | NP_002094 |
MIM | 138570 |
UniProt ID | P13807 |
Chromosome Location | 19q13.3 |
Pathway | Glucose metabolism; Insulin Signaling; Metabolism of carbohydrates |
Function | glucose binding; glycogen (starch) synthase activity; glycogen synthase activity, transferring glucose-1-phosphate |
◆ Recombinant Proteins | ||
RFL33903EF | Recombinant Full Length Inner Membrane Protein Ycca(Ycca) Protein, His-Tagged | +Inquiry |
DGAT2-27397H | Recombinant Human DGAT2, GST-tagged | +Inquiry |
DPP4-2845H | Recombinant Human DPP4 Protein, GST-tagged | +Inquiry |
RARRES2-7426M | Recombinant Mouse RARRES2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNURF-5651R | Recombinant Rat SNURF Protein | +Inquiry |
◆ Native Proteins | ||
APOA1-256H | Native Human APOA1 protein | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
SERPINC1 -50P | Native Porcine Antithrombin III | +Inquiry |
IgM-337G | Native Goat IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
PC-3-173H | PC-3 Whole Cell Lysate | +Inquiry |
RIPPLY2-2331HCL | Recombinant Human RIPPLY2 293 Cell Lysate | +Inquiry |
SGK196-1886HCL | Recombinant Human SGK196 293 Cell Lysate | +Inquiry |
PTPN23-1438HCL | Recombinant Human PTPN23 cell lysate | +Inquiry |
PTPRR-2671HCL | Recombinant Human PTPRR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GYS1 Products
Required fields are marked with *
My Review for All GYS1 Products
Required fields are marked with *
0
Inquiry Basket