Recombinant Human DGAT2, GST-tagged

Cat. No. :	DGAT2-27397H
Description :	This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene.
Source :	wheat germ
Molecular Mass :	70.2 kDa
Sequence :	MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Storagebuffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications :	ELISA; WB
Storage :	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol :	DGAT2

Gene Name	DGAT2 diacylglycerol O-acyltransferase 2 [ Homo sapiens ]
Synonyms	DGAT2; diacylglycerol O-acyltransferase 2; ARAT; HMFN1045; GS1999FULL; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; acyl-CoA retinol O-fatty-acyltransferase; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; EC 2.3.1.20; EC 2.3.1.76
Gene ID	84649
mRNA Refseq	NM_032564
Protein Refseq	NP_115953
MIM	606983
UniProt ID	Q96PD7
Chromosome Location	11q13.5
Pathway	Fat digestion and absorption; Fatty acid, triacylglycerol, and ketone body metabolism; Glycerolipid metabolism
Function	2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity; protein homodimerization activity; retinol O-fatty-acyltransferase activity