Recombinant Human GUK1 Protein (AA 1-198), N-His-Tagged

Cat.No. : GUK1-31H
Product Overview : Recombinant Human GUK1 Protein (AA 1-198) with a N-His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : AA 1-198
Description : The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
AA Sequence : MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Purity : > 95% as determined by SDS-PAGE
Storage : Stored and shipped at -80 centigrade
Storage Buffer : PBS, pH 7.4
Gene Name GUK1 guanylate kinase 1 [ Homo sapiens ]
Official Symbol GUK1
Synonyms GUK1; guanylate kinase 1; guanylate kinase; GMP kinase; ATP:GMP phosphotransferase; GMK; FLJ42686; FLJ43710
Gene ID 2987
mRNA Refseq NM_000858
Protein Refseq NP_000849
MIM 139270
UniProt ID Q16774

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GUK1 Products

Required fields are marked with *

My Review for All GUK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon