Recombinant Human GUK1, His-tagged

• Cat.No.: GUK1-29176TH
• Product Overview: Recombinant full length Human Guanylate kinase with N terminal His tag; 217 amino acids with tag, Predicted MWt 23.9kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 197 amino acids
• Description: The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 23.900kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
• Sequence Similarities: Belongs to the guanylate kinase family.Contains 1 guanylate kinase-like domain.

Gene Information

• Gene Name: GUK1 guanylate kinase 1 [ Homo sapiens ]
• Official Symbol: GUK1
• Synonyms: GUK1; guanylate kinase 1; guanylate kinase
• Gene ID: 2987
• mRNA Refseq: NM_000858
• Protein Refseq: NP_000849
• MIM: 139270
• Uniprot ID: Q16774
• Chromosome Location: 1q32-q41
• Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem
• Function: ATP binding; guanylate kinase activity; kinase activity; nucleotide binding; transferase activity