Recombinant Human GUCY2F Protein, GST-tagged

• Cat.No.: GUCY2F-4494H
• Product Overview: Human GUCY2F partial ORF ( NP_001513, 311 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a guanylyl cyclase found predominantly in photoreceptors in the retina. The encoded protein is thought to be involved in resynthesis of cGMP after light activation of the visual signal transduction cascade, allowing a return to the dark state. This protein is a single-pass type I membrane protein. Defects in this gene may be a cause of X-linked retinitis pigmentosa. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.73 kDa
• AA Sequence: VLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GUCY2F guanylate cyclase 2F, retinal [ Homo sapiens ]
• Official Symbol: GUCY2F
• Synonyms: GUCY2F; guanylate cyclase 2F, retinal; retinal guanylyl cyclase 2; CYGF; GC F; guanylate cyclase 2D like; membrane (retina specific); GUC2DL; RetGC 2; ROS GC2; guanylate cyclase F; rod outer segment membrane guanylate cyclase 2; guanylate cyclase 2D-like, membrane (retina-specific); GC-F; GUC2F; RETGC-2; ROS-GC2
• Gene ID: 2986
• mRNA Refseq: NM_001522
• Protein Refseq: NP_001513
• MIM: 300041
• UniProt ID: P51841