Recombinant Human GRIN2C, Protein A-tagged

Cat.No. : GRIN2C-29051TH
Product Overview : Recombinant full length Human NMDAR2C according to Protein Accession AAH59384.1, with a N terminal proprietary tag: predicted molecular weight 44.88 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D).
Protein length : 171 amino acids
Molecular Weight : 44.880kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Mainly expressed in brain with predominant expression is in the cerebellum, also present in the hippocampus, amygdala, caudate nucleus, corpus callosum, subthalamic nuclei and thalamus. Detected in the heart, skeletal muscle and pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSG PPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQ ICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL SISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEA GIRRDGQGGGG
Sequence Similarities : Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2C/GRIN2C subfamily.
Tag : Non
Gene Name GRIN2C glutamate receptor, ionotropic, N-methyl D-aspartate 2C [ Homo sapiens ]
Official Symbol GRIN2C
Synonyms GRIN2C; glutamate receptor, ionotropic, N-methyl D-aspartate 2C; NMDAR2C; glutamate [NMDA] receptor subunit epsilon-3;
Gene ID 2905
mRNA Refseq NM_000835
Protein Refseq NP_000826
MIM 138254
Uniprot ID Q14957
Chromosome Location 17q24-q25
Pathway Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function N-methyl-D-aspartate selective glutamate receptor activity; cation channel activity; extracellular-glutamate-gated ion channel activity; receptor activity; transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRIN2C Products

Required fields are marked with *

My Review for All GRIN2C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon