Recombinant Human GRIN2C, Protein A-tagged
Cat.No. : | GRIN2C-29051TH |
Product Overview : | Recombinant full length Human NMDAR2C according to Protein Accession AAH59384.1, with a N terminal proprietary tag: predicted molecular weight 44.88 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 171 amino acids |
Description : | N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D). |
Molecular Weight : | 44.880kDa inclusive of tags |
Tissue specificity : | Mainly expressed in brain with predominant expression is in the cerebellum, also present in the hippocampus, amygdala, caudate nucleus, corpus callosum, subthalamic nuclei and thalamus. Detected in the heart, skeletal muscle and pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSG PPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQ ICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL SISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEA GIRRDGQGGGG |
Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2C/GRIN2C subfamily. |
Gene Name | GRIN2C glutamate receptor, ionotropic, N-methyl D-aspartate 2C [ Homo sapiens ] |
Official Symbol | GRIN2C |
Synonyms | GRIN2C; glutamate receptor, ionotropic, N-methyl D-aspartate 2C; NMDAR2C; glutamate [NMDA] receptor subunit epsilon-3; |
Gene ID | 2905 |
mRNA Refseq | NM_000835 |
Protein Refseq | NP_000826 |
MIM | 138254 |
Uniprot ID | Q14957 |
Chromosome Location | 17q24-q25 |
Pathway | Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
Function | N-methyl-D-aspartate selective glutamate receptor activity; cation channel activity; extracellular-glutamate-gated ion channel activity; receptor activity; transporter activity; |
◆ Recombinant Proteins | ||
GRIN2C-2356R | Recombinant Rat GRIN2C Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIN2C-5665HF | Recombinant Full Length Human GRIN2C Protein, GST-tagged | +Inquiry |
GRIN2C-208HF | Recombinant Full Length Human GRIN2C Protein, Protein A-tagged | +Inquiry |
GRIN2C-5346H | Recombinant Human GRIN2C Protein, GST-tagged | +Inquiry |
GRIN2C-29051TH | Recombinant Human GRIN2C, Protein A-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIN2C-5744HCL | Recombinant Human GRIN2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIN2C Products
Required fields are marked with *
My Review for All GRIN2C Products
Required fields are marked with *
0
Inquiry Basket